Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Cynomolgus PD-L1 Protein

Cat. No.: IBDP-530066

Size:

Target Information

Synonyms B7-H|||B7H1|||B7-H1|||PDCD1L1|||CD274 molecule|||CD274|||PDCD1L1|||PDCD1LG1|||PDL1|||PD-L1|||PD-L1B7 homolog 1|||PDL1PDCD1 ligand 1|||programmed cell death 1 ligand 1|||Programmed death ligand 1
Sequence FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLTSLIVYWEMEDKNIIQFVHGEEDLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLLNVTSTLRINTTANEIFYCIFRRLDPEENHTAELVIPELPLALPPNERT

Product Details

Product Type Protein
Species Cynomolgus
Source HEK 293 Cells
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 32-40 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.