Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Cynomolgus Monkey TREM2 Protein

Cat. No.: IBDP-531596

Size:

Target Information

Sequence HNTTVFQGVEGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHN LWLLSFLRRRNGSTAITDDTLGGTLTITLRNLQPHDAGFYQCQSLHGSEA DTLRKVLVEVLADPLDHRDAGDLWVPGESESFEDAHVEHSISRSLLEGEI PFPPTS
Sequence Similarities Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Amino Acids 19 to 174
Cellular Localization Secreted and Cell membrane.
Tissue Specificity Expressed on macrophages and dendritic cells but not on granulocytes or monocytes. In the CNS strongest expression seen in the basal ganglia, corpus callosum, medulla oblongata and spinal cord.
Function May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells.

Product Details

Product Type Protein
Species Cynomolgus Monkey
Source HEK 293 Cells
Endotoxin Level ≤0.005 Eu/µg
Protein Length Full length protein
Molecular Weight 18 kDa
Purity ≥95%
Active No
Animal free Yes
Nature Recombinant
Application HPLC, MS, SDS-PAGE

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at Room Temperature.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.