Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Cynomolgus CD40 Protein

Cat. No.: IBDP-530063

Size:

Target Information

Synonyms rCynB-cell surface antigen CD40, Fc|||Tumor Necrosis Factor Receptor Superfamily member 5|||B-Cell Surface Antigen CD40|||Bp50|||CD40L Receptor|||CDw40|||CD40|||TNFRSF5
Sequence EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETRCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGLHCTSESCESCVPHRSCLPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCRPWTSCETKDLVVQQAGTNKTDVVCGPQDRQR

Product Details

Product Type Protein
Species Cynomolgus
Source HEK 293 Cells
Tag hFc
Endotoxin Level <1.0 Eu/µg
Molecular Weight 48-60 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.