Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Cynomolgus CD3 gamma Protein

Cat. No.: IBDP-531357

Size:

Target Information

Synonyms CD3GT-cell surface glycoprotein CD3 gamma chain|||T-cell receptor T3 gamma chain|||CD antigen CD3g
Sequence QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT

Product Details

Product Type Protein
Species Cynomolgus
Source P. pastoris
Tag His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 12.5 kDa
Purity ≥90%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.