Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Cynomolgus CD3 epsilon Protein

Cat. No.: IBDP-531356

Size:

Target Information

Synonyms CD3e antigen|||CD3e antigen, epsilon polypeptide (TiT3 complex)|||CD3e molecule, epsilon (CD3-TCR complex)|||CD3e|||CD3-epsilon|||FLJ18683|||T3E|||T-cell antigen receptor complex, epsilon subunit of T3|||T-cell surface antigen T3/Leu-4 epsilon chain
Sequence QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMD

Product Details

Product Type Protein
Species Cynomolgus
Source HEK 293 Cells
Tag Fc Tag, hFc Tag
Endotoxin Level <1.0 Eu/µg
Molecular Weight 38-55 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.