Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Cynomolgus CD3 delta Protein

Cat. No.: IBDP-531358

Size:

Target Information

Synonyms rCynT-cell surface glycoprotein CD3 delta chain/CD3d, Fc |||T-cell surface glycoprotein CD3 delta chain|||T-cell receptor T3 delta chain|||CD3d|||CD3D
Sequence FKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLA

Product Details

Product Type Protein
Species Cynomolgus
Source HEK 293 Cells
Tag hFc
Endotoxin Level <1.0 Eu/µg
Molecular Weight 35.0 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.