Cat. No.: IBDP-530012
Size:
Online InquiryTarget Information
| Synonyms | CD137|||ILA|||TNFRSF9|||4-1BB ligand receptor|||CDw137|||T-cell antigen 4-1BB homolog|||T-cell antigen ILA |
| Sequence | LQDLCSNCPAGTFCDNNRSQICSPCPPNSFSSAGGQRTCDICRQCKGVFKTRKECSSTSNAECDCISGYHCLGAECSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSATPPAPAREPGHSPQ |
| Function | 4-1BB (CD137; TNFRSF9), is a surface glycoprotein, a receptor of TNFSF9/4-1BBL, belongs to the tumor necrosis factor (TNF) receptor superfamily. 4-1BB is helpful for T cell activation and development, and also induces peripheral mononuclear cell proliferation and migration to the tumor microenvironment. 4-1BB is also involved in enhancing Nrf2 and NF-κB pathway mediated apoptosis of endothelial cells. CD137/4-1BB Protein, Cynomolgus (HEK293, His) has 163 amino acids (L24-Q186), produced by HEK293 cells with C-terminal 6*His-tag. |
Product Details
| Product Type | Protein |
| Species | Cynomolgus |
| Source | HEK 293 Cells |
| Tag | 6*His |
| Endotoxin Level | <1.0 Eu/µg |
| Molecular Weight | 26-35 kDa |
| Purity | ≥95% |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C. |
| Handling | Avoid freeze / thaw cycle. |