Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Cynomolgus BCMA/TNFRSF17 Protein

Cat. No.: IBDP-530068

Size:

Target Information

Synonyms Tumor necrosis factor receptor superfamily member 17|||B-cell maturation protein|||CD269|||Tnfrsf17|||Bcm|||Bcma
Sequence MLQMARQCSQNEYFDSLLHDCKPCQLRCSSTPPLTCQRYCNASMTNSVKGMNA
Function B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is used as a biomarker for Multiple myeloma (MM). BCMA mainly plays an important role in B cells for their proliferation, survival and also differentiates them into plasma cells. BCMA/TNFRSF17 Protein, Cynomolgus (HEK293, His) is a recombinant protein with a C-Terminal His label, It consists of 53 amino acids (M1-A53) and is produced in HEK293 cells.

Product Details

Product Type Protein
Species Cynomolgus
Source HEK 293 Cells
Tag 6*His
Endotoxin Level <1.0 Eu/µg
Purity ≥90%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.