Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Canine TFF3 Protein

Cat. No.: IBDP-531262

Size:

Target Information

Synonyms TFF3|||trefoil factor 3 (intestinal)|||ITF|||Polypeptide P1.B|||TFI|||HITF|||trefoil factor 3, HITF, human intestinal trefoil factor|||OTTHUMP00000109349|||P1B|||trefoil factor 3|||hITF|||hP1.B|||Intestinal trefoil factor
Sequence YQGLATNLCEVPPKDRVDCGYPEITSEQCVNRGCCFDSSIHGVPWCFKPLQDTECRF

Product Details

Product Type Protein
Species Canine
Source HEK 293 Cells
Tag 10*His
Endotoxin Level <1.0 Eu/µg
Molecular Weight 9.2 kDa
Purity ≥90%

Storage & Handling

Shipping Shipped with Dry Ice.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.