Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Recombinant Canine IL-3 Protein

Cat. No.: IBDP-531399

Size:

Target Information

Synonyms rCaIL-3|||Mast cell growth factor|||MCGF|||Hematopoietic growth factor
Sequence RPFSTDLPKQYFTMINEIMEMLNKSPSPSEEPLDSNEKETLLEDTLLRPNLDVFLNASSKFHKNGLLIWNNLKEFLPLLPTPTPRGEPISIMENNWGDFQRKLKKYLEALDNFLNFKNKP
Function IL-3 Protein, Canine is a hemopoietic growth factor involved in the survival, proliferation and differentiation of multipotent hemopoietic cells.

Product Details

Product Type Protein
Species Canine
Source E. coli
Tag Tag Free
Endotoxin Level <1.0 Eu/µg
Molecular Weight 14.0 kDa
Purity ≥95%

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.