Psalmotoxin 1

Cat. No.: IBDI-438403

Psalmotoxin 1 (PcTx1) is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H + of ASIC1a. Psalmotoxin 1 can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 can be used in the research of cancers, or neurological disease.

Product Details

Target	Sodium Channel | Apoptosis
Molecular Weight	4689.41
Appearance	Solid
Synonyms	PcTx1, Psalmopoeus cambridgei toxin-1
Sequence Shortening	EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Cys17-Cys33)
Purity	≥99.0%

Storage & Handling

Shipping	Room temperature in continental US. May vary elsewhere.
Storage	Powder: -80°C/2 years; -20°C/1 year *In solvent : -80°C, 6 months; -20°C, 1 month
Handling	Sealed storage, away from moisture
Regulatory Status	This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.