Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Parstatin(human)

Cat. No.: IBDI-438538

Parstatin(human), a cell-penetrating PAR-1 thrombin receptor agonist peptide, is a potent inhibitor of angiogenesis.

Size (Solid):

Product Details

Target Protease | Activated Receptor (PAR)
Molecular Weight 4467.26
Sequence Shortening MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR

Storage & Handling

Shipping Room temperature in continental US. May vary elsewhere.
Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Regulatory Status This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.
! For research use only, not intended for any clinical use.