Products
  1. Home
  2. Products
  3. Inhibitors & Activators for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Human growth hormone-releasing factor

Cat. No.: IBDI-438384

Human growth hormone-releasing factor (Growth Hormone Releasing Factor human) is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary.

Size (Solid):

Product Details

Target GHSR
Molecular Weight 5039.65
Appearance Solid
Synonyms Growth Hormone Releasing Factor human
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2
Sequence Shortening YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

Storage & Handling

Shipping Room temperature in continental US. May vary elsewhere.
Storage Powder: -80°C/2 years; -20°C/1 year
*In solvent : -80°C, 6 months; -20°C, 1 month
Handling Sealed storage, away from moisture
Regulatory Status This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.