Products
  1. Home
  2. Products
  3. Inhibitors & Activators for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Human β-defensin-2

Cat. No.: IBDI-438320

Human β-defensin-2 (HβD-2) is a small cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by a number of epithelial cells.Human β-defensin-2 has antimicrobial activity against gram-negative bacteria and Candida, but not gram-positive Staphylococcus aureus. Human β-defensin-2 can be used for the study of colitis.

Size (Solid):

Product Details

Target Antibiotic | Bacterial
Molecular Weight 4328.20
Synonyms HβD-2
Sequence Gly-Ile-Gly-Asp-Pro-Val-Thr-Cys-Leu-Lys-Ser-Gly-Ala-Ile-Cys-His-Pro-Val-Phe-Cys-Pro-Arg-Arg-Tyr-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Leu-Pro-Gly-Thr-Lys-Cys-Cys-Lys-Lys-Pro (Disulfide bridge:Cys8-Cys37; Cys15-Cys30; Cys20-Cys38)
Sequence Shortening GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP (Disulfide bridge:Cys8-Cys37; Cys15-Cys30; Cys20-Cys38)

Storage & Handling

Shipping Room temperature in continental US. May vary elsewhere.
Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Regulatory Status This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.