Cat. No.: IBDI-430654
Product Details
Target | Endogenous Metabolite | Apoptosis |
Molecular Weight | 3766.20 |
Sequence | His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp |
Sequence Shortening | HADGSFSDEMNTILDNLAARDFINWLIQTKITD |
Structure Classification | Others |
Storage & Handling
Shipping | Room temperature in continental US. May vary elsewhere. |
Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Regulatory Status | This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. |