Products
  1. Home
  2. Products
  3. Inhibitors & Activators for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

GLP-2(rat) TFA

Cat. No.: IBDI-438333

GLP-2(rat) TFA is an intestinal growth factor. GLP-2(rat) TFA stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) TFA enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).

Size (Solid):

Product Details

Target Apoptosis
Molecular Weight 3910.16
Sequence His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp
Sequence Shortening HADGSFSDEMNTILDNLATRDFINWLIQTKITD

Storage & Handling

Shipping Room temperature in continental US. May vary elsewhere.
Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Regulatory Status This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.