Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

GLP-2(rat)

Cat. No.: IBDI-438411

GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).

Size (Solid):

Product Details

Target Apoptosis
Molecular Weight 3796.14
Appearance Solid
Sequence His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp
Sequence Shortening HADGSFSDEMNTILDNLATRDFINWLIQTKITD
Purity 98.04%

Storage & Handling

Shipping Room temperature in continental US. May vary elsewhere.
Storage Powder: -80°C/2 years; -20°C/1 year
*In solvent : -80°C, 6 months; -20°C, 1 month
Handling Sealed storage, away from moisture and light, under nitrogen
Regulatory Status This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.
! For research use only, not intended for any clinical use.