Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

GLP-1(7-37)

Cat. No.: IBDI-438249

GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.

Size (Solid):

Product Details

Target GCGR
Molecular Weight 3355.67
Appearance Solid
Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly
Sequence Shortening HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

Storage & Handling

Shipping Room temperature in continental US. May vary elsewhere.
Storage Powder: -80°C/2 years; -20°C/1 year
*In solvent : -80°C, 6 months; -20°C, 1 month
Handling Sealed storage, away from moisture and light
Regulatory Status This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.
! For research use only, not intended for any clinical use.