Cat. No.: IBDI-438280
Product Details
Target | GCGR |
Molecular Weight | 3411.65 |
Appearance | Solid |
Synonyms | Glucagon-like peptide-1 (GLP-1)(7-36), amide TFA, Human GLP-1 (7-36), amide TFA |
Sequence Shortening | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRNH2 |
Purity | 98.04% |
Storage & Handling
Shipping | Room temperature in continental US. May vary elsewhere. |
Storage | Powder: -80°C/2 years; -20°C/1 year *In solvent : -80°C, 6 months; -20°C, 1 month |
Handling | Sealed storage, away from moisture and light |
Regulatory Status | This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. |