Cat. No.: IBDI-438250
Product Details
| Target | GCGR |
| Molecular Weight | 3357.73 |
| Appearance | Solid |
| Synonyms | Glucagon-like peptide-1 (GLP-1)(7-36), amide acetate, Human GLP-1 (7-36), amide acetate |
| Sequence | His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 |
| Sequence Shortening | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRNH2 |
| Purity | 98.62% |
Storage & Handling
| Shipping | Room temperature in continental US. May vary elsewhere. |
| Storage | Powder: -80°C/2 years; -20°C/1 year *In solvent : -80°C, 6 months; -20°C, 1 month |
| Handling | Sealed storage, away from moisture and light |
| Regulatory Status | This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. |