Cat. No.: IBDI-438470
Product Details
| Target | Insulin Receptor |
| Molecular Weight | 4975.55 |
| Appearance | Solid |
| Sequence Shortening | YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ |
| Purity | 99.03% |
Storage & Handling
| Shipping | Room temperature in continental US. May vary elsewhere. |
| Storage | Powder: -80°C/2 years; -20°C/1 year *In solvent : -80°C, 6 months; -20°C, 1 month |
| Handling | Sealed storage, away from moisture and light, under nitrogen |
| Regulatory Status | This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. |