Epidermal growth factor (EGF)

Cat. No.: IBDI-438269

Epidermal growth factor (EGF) is the key regulatory factor in promoting cell survival. Epidermal growth factor (EGF) signaling pathways are related with apoptosis. Loss of Epidermal growth factor (EGF) leads to embryonic or perinatal lethality with abnormalities in multiple organs. Epidermal growth factor (EGF) can stimulate reactive oxygen species (ROS) production for a short period of time in cells. Epidermal growth factor (EGF) can be used to research development and cancer.

Product Details

Target	Apoptosis | Reactive Oxygen Species
Molecular Weight	6215.98
Sequence	Asn-Ser-Asp-Ser-Glu-Cys-Pro-Leu-Ser-His-Asp-Gly-Tyr-Cys-Leu-His-Asp-Gly-Val-Cys-Met-Tyr-Ile-Glu-Ala-Leu-Asp-Lys-Tyr-Ala-Cys-Asn-Cys-Val-Val-Gly-Tyr-Ile-Gly-Glu-Arg-Cys-Gln-Tyr-Arg-Asp-Leu-Lys-Trp-Trp-Glu-Leu-Arg (Disulfide bridge: Cys6-Cys20; Cys14-Cys31; Cys33-Cys42)
Sequence Shortening	NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR (Disulfide bridge: Cys6-Cys20; Cys14-Cys31; Cys33-Cys42)

Storage & Handling

Shipping	Room temperature in continental US. May vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Regulatory Status	This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.