Cat. No.: IBDI-438479
Product Details
Target | Apelin Receptor (APJ) |
Molecular Weight | 4081.84 |
Appearance | Solid |
Sequence Shortening | QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP (Disulfide bridge: Cys17-Cys22) |
Purity | 99.27% |
Storage & Handling
Shipping | Room temperature in continental US. May vary elsewhere. |
Storage | Powder: -80°C/2 years; -20°C/1 year *In solvent : -80°C, 6 months; -20°C, 1 month |
Handling | Sealed storage, away from moisture and light, under nitrogen |
Regulatory Status | This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. |