Defensin HNP-1 human TFA

Cat. No.: IBDI-438428

Defensin HNP-1 human TFA is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human TFA exhibits broad antimicrobial and anti-leishmanial activities.

Product Details

Target	Bacterial | PaRasite
Molecular Weight	3556.05
Appearance	Solid
Sequence Shortening	ACYCRIPACIAGERRYGTCIYQGRLWAFCC
Purity	98.16%

Storage & Handling

Shipping	Room temperature in continental US. May vary elsewhere.
Storage	Powder: -80°C/2 years; -20°C/1 year *In solvent : -80°C, 6 months; -20°C, 1 month
Handling	Sealed storage, away from moisture
Regulatory Status	This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.