Cat. No.: IBDP-532103
Size:
Online InquiryTarget Information
| Sequence | ACYCRIPACIAGERRYGTCIYQGRLWAFCC |
| Function | Defensin HNP-1 human TFA is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human TFA exhibits broad antimicrobial and anti-leishmanial activities. |
Product Details
| Product Type | Peptide |
| Molecular Weight | 3556.05 kDa |
| Purity | 0.9816 |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |