Cat. No.: IBDP-532015
Size:
Online InquiryTarget Information
| Sequence | YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR |
| Function | Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R), a chimeric peptide consisting of 29 amino acids, is synthesized by adding nona-arginine motif to the carboxy terminus of RVG (rabies virus glycoprotein). Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R) is positively charged and able to bind negatively charged nucleic acids via charge interaction. |
Product Details
| Product Type | Peptide |
| Cas | 1678417-57-6 |
| Molecular Weight | 4843.45 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |