Products
  1. Home
  2. Products
  3. Inhibitors & Activators for IBD Research
Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

β-CGRP, human TFA

Cat. No.: IBDI-438236

β-CGRP, human TFA (Human β-CGRP TFA) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells.

Size (Solid):

Product Details

Target CGRP Receptor
Molecular Weight 3907.38
Appearance Solid
Synonyms Human β-CGRP TFA, CGRP-II
Sequence Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2(Disulfide bridge: Cys2-Cys7)
Sequence Shortening ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2(Disulfide bridge: Cys2-Cys7)
Purity 99.10%

Storage & Handling

Shipping Room temperature in continental US. May vary elsewhere.
Storage Powder: -80°C/2 years; -20°C/1 year
*In solvent : -80°C, 6 months; -20°C, 1 month
Handling Sealed storage, away from moisture
Regulatory Status This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.
! For research use only, not intended for any clinical use.
Copyright © Ace Therapeutics. All rights reserved.