Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

β-CGRP, human

Cat. No.: IBDI-438237

β-CGRP, human (Human β-CGRP) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells.

Size (Solid):

Product Details

Target CGRP Receptor
Molecular Weight 3793.41
Synonyms Human β-CGRP, CGRP-II
Sequence Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2(Disulfide bridge: Cys2-Cys7)
Sequence Shortening ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2(Disulfide bridge: Cys2-Cys7)

Storage & Handling

Shipping Room temperature in continental US. May vary elsewhere.
Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Regulatory Status This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.
! For research use only, not intended for any clinical use.