Cat. No.: IBDP-532002
Size:
Online InquiryTarget Information
| Sequence | WNPFKELEKVGQRVRDAVISAGPAVATVAQATALAK-NH2 |
| Function | Cecropin D is an antimicrobial peptide with a MIC of 4.55 μg/mL. Cecropin D is effective against both Gram-negative and Gram-positive bacteria. Cecropin D has antiviral, antifungal, antitumor, and immunomodulatory. |
Product Details
| Product Type | Peptide |
| Cas | 83652-32-8 |
| Molecular Weight | 4043.59 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |