Cat. No.: IBDP-531979
Size:
Online InquiryTarget Information
| Synonyms | Myrcludex B |
| Sequence | {Myr}-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2 |
| Function | Bulevirtide (Myrcludex B) is a NTCP inhibitor, a linear lipopeptide of 47 amino acids. Bulevirtide inhibits HBV and HDV entry into liver cells, blocks HBV infection in hepatocytes, and participates in HBV transcriptional suppression. Bulevirtide can be used in HDV infection and compensated cirrhosis research. |
Product Details
| Product Type | Peptide |
| Cas | 2012558-47-1 |
| Molecular Weight | 5398.86 kDa |
| Purity | 0.9819 |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |