Cat. No.: IBDP-532048
Size:
Online InquiryTarget Information
| Synonyms | Corticotropin Releasing Factor bovine TFA |
| Sequence | SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2 |
| Function | CRF, bovine (TFA) is a potent agonist of CRF receptor, and displaces [125I-Tyr]ovine CRF with a Ki of 3.52 nM. |
Product Details
| Product Type | Peptide |
| Molecular Weight | 4811.36 kDa |
| Purity | 0.9686 |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |