Cat. No.: IBDP-531958
Size:
Online InquiryTarget Information
| Sequence | {Glp}LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2 |
| Function | Big Gastrin I, human (TFA) is a gastrointestinal hormone consisting of 34 amino acids. Big Gastrin I, human (TFA) can be used as a potential substance for the study of cancer, autoimmune diseases, fibrotic diseases, inflammatory diseases, neurological diseases or cardiovascular diseases. |
Product Details
| Product Type | Peptide |
| Molecular Weight | 3963.21 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |