Cat. No.: IBDP-531957
Size:
Online InquiryTarget Information
| Sequence | MRALCLLLLTVCLLSSQLAAGINLLTGLGQRSDHYICAKKGGTCNFSPCPLFNRIEGTCYSGKAKCCIR |
| Function | Beta-defensin 1, pig TFA is an antimicrobial peptide found primarily in tongue mucosa of pig. Beta-defensin 1, pig TFA is active against bacteria such as Escherichia coli, Salmonella typhimurium, Listeria monocytogenes, Staphylococcus aureus, Bordetella pertussis and Candida albicans. |
Product Details
| Product Type | Peptide |
| Molecular Weight | 7524.92 kDa |
Storage & Handling
| Shipping | Shipped at Room Temperature. |
| Storage | Store at -20 °C or -80 °C. |
| Handling | Avoid freeze / thaw cycle. |