Products
Inquiry

* Please note that all of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.

Beinaglutide

Cat. No.: IBDP-531952

Size:

Target Information

Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Function Beinaglutide is a recombinant human GLP-1 (rhGLP-1) polypeptide that shares almost 100% homology with human GLP-1 (7–36). Beinaglutide displays does-dependent effects in glycemic control, inhibiting food intake and gastric empty and promoting weight loss. Beinaglutide has the potential for the research of overweight/obesity and nonalcoholic steatohepatitis (NASH).

Product Details

Product Type Peptide
Cas 123475-27-4
Molecular Weight 3298.61 kDa
Purity 0.9947

Storage & Handling

Shipping Shipped at Room Temperature.
Storage Store at -20 °C or -80 °C.
Handling Avoid freeze / thaw cycle.
! For research use only, not intended for any clinical use.