Aviptadil acetate

Cat. No.: IBDI-438283

Aviptadil acetate is an analog vasoactive intestinal polypeptide (VIP) with potent vasodilatory effects. Aviptadil acetate induces pulmonary vasodilation and inhibits vascular SMCs proliferation, platelet aggregation. Aviptadil acetate can be used for the research of pulmonary fibrosis, pulmonary arterial hypertension (PAH) and SARS-CoV-2 caused respiratory failure, et al.

Product Details

Target	SARS-CoV
Molecular Weight	3385.90
Appearance	Solid
Synonyms	Vasoactive Intestinal Peptide acetate salt (human, rat, mouse, rabbit, canine, porcine
Sequence Shortening	HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Purity	98.78%

Storage & Handling

Shipping	Room temperature in continental US. May vary elsewhere.
Storage	Powder: -80°C/2 years; -20°C/1 year *In solvent : -80°C, 6 months; -20°C, 1 month
Handling	Sealed storage, away from moisture and light
Regulatory Status	This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.