Cat. No.: IBDP-531911
Size:
Online InquiryTarget Information
Sequence | HGFQWPGSWTWENGKWTWKGAYQFLKGGGGSRRRRRRRRR |
Function | APTSTAT3-9R, a specific STAT3-binding peptide, inhibits STAT3 activation and downstream signaling by specifically blocking STAT3 phosphorylation. APTSTAT3-9R exerts antiproliferative effects and antitumor activity. |
Product Details
Product Type | Peptide |
Molecular Weight | 4947.51 kDa |
Purity | 0.9955 |
Storage & Handling
Shipping | Shipped at Room Temperature. |
Storage | Store at -20 °C or -80 °C. |
Handling | Avoid freeze / thaw cycle. |