Apelin-36(rat, mouse) TFA

Cat. No.: IBDI-438355

Apelin-36(rat, mouse) TFA is an endogenous orphan G protein-coupled receptor APJ agonist. Apelin-36(rat, mouse) TFA binds to APJ receptors with an IC50 of 5.4 nM, and potently inhibits cAMP production with an EC50 of 0.52 nM. Apelin-36(rat, mouse) TFA blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ.

Product Details

Target	HIV
Molecular Weight	4314.91
Sequence	Leu-Val-Lys-Pro-Arg-Thr-Ser-Arg-Thr-Gly-Pro-Gly-Ala-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe
Sequence Shortening	LVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF

Storage & Handling

Shipping	Room temperature in continental US. May vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Regulatory Status	This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.