Apelin-36(human) TFA

Cat. No.: IBDI-438352

Apelin-36(human) TFA is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) TFA shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC550=8.61). Apelin-36(human) TFA has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) TFA inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ.

Product Details

Target	HIV
Molecular Weight	4309.85
Sequence	Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe
Sequence Shortening	LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF

Storage & Handling

Shipping	Room temperature in continental US. May vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Regulatory Status	This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.