Apelin-36(human)

Cat. No.: IBDI-438424

Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC50=8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ.

Product Details

Target	HIV
Molecular Weight	4195.83
Appearance	Solid
Sequence	Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe
Sequence Shortening	LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
Purity	98.11%

Storage & Handling

Shipping	Room temperature in continental US. May vary elsewhere.
Storage	Powder: -80°C/2 years; -20°C/1 year *In solvent : -80°C, 6 months; -20°C, 1 month
Handling	Sealed storage, away from moisture and light, under nitrogen
Regulatory Status	This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.