Amylin (IAP; P), feline TFA

Cat. No.: IBDI-438358

Amylin (IAP; P), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAP; P), feline TFA is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAP; P), feline TFA is a regulatory peptide, which inhibits insulin and glucagon secretion.

Product Details

Target	Amylin Receptor
Molecular Weight	4024.47
Appearance	Solid
Sequence	Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Ile-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Ala-Ile-Leu-Ser-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: Cys2-Cys7)
Sequence Shortening	KCNTATCATQRLANFLIRSSNNLGAILSPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7)
Purity	98.75%

Storage & Handling

Shipping	Room temperature in continental US. May vary elsewhere.
Storage	Powder: -80°C/2 years; -20°C/1 year *In solvent : -80°C, 6 months; -20°C, 1 month
Handling	Sealed storage, away from moisture
Regulatory Status	This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.