Amylin (IAP; P), feline

Cat. No.: IBDI-438359

Amylin (IAP; P), feline is a 37-amino acid polypeptide from feline. Amylin (IAP; P), feline is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAP; P), feline is a regulatory peptide, which inhibits insulin and glucagon secretion.

Product Details

Target	Amylin Receptor
Molecular Weight	3910.45
Sequence	Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Ile-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Ala-Ile-Leu-Ser-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge: Cys2-Cys7)
Sequence Shortening	KCNTATCATQRLANFLIRSSNNLGAILSPTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7)

Storage & Handling

Shipping	Room temperature in continental US. May vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Regulatory Status	This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use.