Cat. No.: IBDI-438297
Product Details
Target | Akt |
Molecular Weight | 4499.82 |
Sequence | Cys-His-Ser-Arg-Ser-Ala-Asp-Val-Asp-Ser-Leu-Ser-Glu-Ser-Ser-Pro-Asn-Ser-Ser-Pro-Gly-Pro-Cys-Pro-Glu-Lys-Ala-Pro-Pro-Pro-Gln-Lys-Pro-Ser-His-Glu-Gly-Ser-Tyr-Leu-Leu-Gln-Pro (Disulfide bridge: Cys1-Cys23) |
Sequence Shortening | CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP (Disulfide bridge: Cys1-Cys23) |
Storage & Handling
Shipping | Room temperature in continental US. May vary elsewhere. |
Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Regulatory Status | This product is for RESEARCH USE ONLY and is not intended for therapeutic or diagnostic use. |