x
- Home
- About Diabetes
- Services
- Diabetes Mellitus Modeling Solutions
- R&D Services for Diabetes Mellitus and Diabetic Complications
- By Drug Development Process
- About Us
- Careers
- Contact Us
Cat. No.: DPP-001092
| Product Overview | |
|---|---|
| Species | Rat |
| Expression System | Escherichia coli |
| Format | Lyophilized |
| Purity | ≥ 90% by HPLC |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | Il1a |
| UniProt No. | P16598 |
| Gene ID | 24493 |
| Molecular Weight | 18 kDa |
| Alternative Names | BAF; FAF; Hematopoietin 1; Hematopoietin-1; IL 1 alpha; IL 1A; IL-1 alpha; Il-1a; IL1; IL1 ALPHA; IL1A; IL1A_HUMAN; IL1F1; Interleukin 1 alpha; Interleukin-1 alpha; Interleukin1 alpha; LAF; LEM; Preinterleukin 1 alpha; Pro interleukin 1 alpha |
| Function | Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. |
| Cellular Localization | Secreted. The lack of a specific hydrophobic segment in the precursor sequence suggests that IL-1 is released by damaged cells or is secreted by a mechanism differing from that used for other secretory proteins. |
| Protein Length | Protein fragment |
| Sequence | SAPHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQ LEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETP KLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSM IDFQIS,Belongs to the IL-1 family. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.
