Cat. No.: DPP-001154
Product Overview | |
---|---|
Species | Mouse |
Expression System | Escherichia coli |
Format | Liquid |
Purity | ≥97% by SDS-PAGE |
Nature | Recombinant |
Target Information | |
---|---|
Gene Name | Reg1 |
UniProt No. | P43137 |
Gene ID | 19692 |
Molecular Weight | 32 kDa including tags |
Alternative Names | ICRF; Islet cells regeneration factor; Islet of Langerhans regenerating protein; Lithostathine 1 beta; Lithostathine-1-alpha; P19; Pancreatic stone protein; Pancreatic stone protein 2; Pancreatic thread protein; PSP; PSPS; PSPS1; PSPS2; PTP; REG; REG 1 beta; REG-1-alpha; REG1A; REG1A_HUMAN; REG1B; Regenerating islet derived protein 1 beta; Regenerating islet-derived protein 1-alpha; Regenerating protein I alpha; REGL |
Function | Might act as an inhibitor of spontaneous calcium carbonate precipitation. May be associated with neuronal sprouting in brain, and with brain and pancreas regeneration. |
Cellular Localization | Secreted. |
Protein Length | Full length protein |
Sequence | QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYL VSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYK SWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG,Contains 1 C-type lectin domain. |
Shipping & Storage | |
---|---|
Shipping | Shipped on dry ice. |
Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of wellknown experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.