x
- Home
- About Diabetes
- Services
- Diabetes Mellitus Modeling Solutions
- R&D Services for Diabetes Mellitus and Diabetic Complications
- By Drug Development Process
- About Us
- Careers
- Contact Us
Cat. No.: DPP-001043
| Product Overview | |
|---|---|
| Species | Mouse |
| Expression System | Escherichia coli |
| Format | Liquid |
| Purity | ≥95% by SDS-PAGE |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | Ins1 |
| UniProt No. | P01325 |
| Gene ID | 16333 |
| Molecular Weight | 12 kDa |
| Alternative Names | IDDM; IDDM1; IDDM2; ILPR; ins; INS_HUMAN; Insulin A chain; Insulin B chain; IRDN; MODY10; Preproinsulin; Proinsulin; Proinsulin precursor |
| Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. |
| Involvement In Disease | Defects in INS are the cause of familial hyperproinsulinemia (FHPRI) .Defects in INS are a cause of diabetes mellitus insulin-dependent type 2 (IDDM2). IDDM2 is a multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels.Defects in INS are a cause of diabetes mellitus permanent neonatal (PNDM). PNDM is a rare form of diabetes distinct from childhood-onset autoimmune diabetes mellitus type 1. It is characterized by insulin-requiring hyperglycemia that is diagnosed within the first months of life. Permanent neonatal diabetes requires lifelong therapy.Defects in INS are a cause of maturity-onset diabetes of the young type 10 (MODY10). MODY10 is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease. |
| Cellular Localization | Secreted. |
| Protein Length | Full length protein |
| Sequence | FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGD LQTLALEVARQKRGIVDQCCTSICSLYQLENYCN,Belongs to the insulin family. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.
