x
- Home
- About Diabetes
- Services
- Diabetes Mellitus Modeling Solutions
- R&D Services for Diabetes Mellitus and Diabetic Complications
- By Drug Development Process
- About Us
- Careers
- Contact Us
Cat. No.: DPP-001124
| Product Overview | |
|---|---|
| Species | Mouse |
| Expression System | Escherichia coli |
| Format | Liquid |
| Purity | ≥97% by SDS-PAGE |
| Nature | Recombinant |
| Target Information | |
|---|---|
| Gene Name | Dbi |
| UniProt No. | P31786 |
| Gene ID | 13167 |
| Molecular Weight | 12 kDa including tags |
| Alternative Names | ACBD 1; ACBD1; ACBP; ACBP_HUMAN; Acyl CoA binding domain containing 1; Acyl CoA binding protein; Acyl Coenzyme A binding domain containing 1; Acyl coenzyme A binding protein; Acyl-CoA-binding protein; CCK RP; CCKRP; Cholecystokinin releasing peptide trypsin sensitive; DBI; Diazepam-binding inhibitor; Endozepine; EP; GABA receptor modulator; MGC70414 |
| Function | Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor. |
| Protein Length | Full length protein |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSMSQAEFDKAAEEVKRLKTQPTDEEMLF IYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEK VDELKKKYG,Belongs to the ACBP family. Contains 1 ACB (acyl-CoA-binding) domain. |
| Shipping & Storage | |
|---|---|
| Shipping | Shipped on dry ice. |
| Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.
