Recombinant Human USF1 Protein (BSA and azide free)

Recombinant Human USF1 Protein (BSA and azide free)

Cat. No.: DPP-001098

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System Escherichia coli
Format Liquid
Purity ≥97% by SDS-PAGE
Nature Recombinant
Target Information
Gene Name USF1
UniProt No. P22415
Gene ID 7391
Molecular Weight 36 kDa including tags
Alternative Names bHLHb11; Class B basic helix-loop-helix protein 11; FCHL; FCHL 1; FCHL1; HGNC:12593; HYPLIP 1; HYPLIP1; Major late transcription factor; Major late transcription factor 1; MLTF; MLTF I; MLTFI; Transcription factor USF-1; UEF; Upstream stimulatory factor 1; Upstream transcription factor 1; Upstream transcription factor 1, isoform CRA_a; USF; USF 1
Cellular Localization Nuclear
Protein Length Full length protein
Sequence MGSSHHHHHH SSGLVPRGSH MGSMKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNV KYVFRTENGGQVMYRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQG AFTSDDAVDTEGTAAETHYTYFPSTAVGDGAGGTTSGSTAAVVTTQGSEA LLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAPRTTRD EKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKA CDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLR HHGLEVVIKNDSN
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of wellknown experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Quick Links
Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top