Cat. No.: DPP-001108
Product Overview | |
---|---|
Species | Human |
Expression System | Wheat germ |
Format | Liquid |
Purity | ≥ 70% by HPLC |
Nature | Recombinant |
Target Information | |
---|---|
Gene Name | UCP1 |
UniProt No. | P25874 |
Gene ID | 7350 |
Molecular Weight | 30 kDa including tags |
Alternative Names | mitochondrial brown fat uncoupling protein; Mitochondrial brown fat uncoupling protein 1; SLC25A7; Solute carrier family 25 member 7; Thermogenin; UCP; UCP 1; UCP1; UCP1_HUMAN; Uncoupling protein 1; uncoupling protein 1 (mitochondrial, proton carrier) |
Function | UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat. |
Cellular Localization | Mitochondrion inner membrane. |
Protein Length | Protein fragment |
Sequence | PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF,Belongs to the mitochondrial carrier family. Contains 3 Solcar repeats. |
Shipping & Storage | |
---|---|
Shipping | Shipped on dry ice. |
Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of wellknown experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.