Recombinant Human UBE2I / UBC9 Protein (BSA and azide free)

Recombinant Human UBE2I / UBC9 Protein (BSA and azide free)

Cat. No.: DPP-001181

Size: 50 µg Size: 100 µg Size: Costomer Size
Product Overview
Species Human
Expression System Escherichia coli
Endotoxin Level < 1.000 Eu/µg
Format Liquid
Purity ≥ 95% by Densitometry
Nature Recombinant
Target Information
Gene Name UBE2I
UniProt No. P63279
Gene ID 7329
Molecular Weight 44 kDa including tags
Alternative Names C358B7.1; p18; SUMO 1 protein ligase; SUMO conjugating enzyme UBC9; SUMO-conjugating enzyme UBC9; SUMO-protein ligase; SUMO1 protein ligase; UBC9; UBC9_HUMAN; UBCE9; Ube2i; Ubiquitin carrier protein; Ubiquitin carrier protein 9; Ubiquitin carrier protein I; Ubiquitin conjugating enzyme 9; Ubiquitin conjugating enzyme E2I (homologous to yeast UBC9); Ubiquitin conjugating enzyme E2I (UBC9 homolog, yeast); Ubiquitin conjugating enzyme UbcE2A; Ubiquitin like protein SUMO 1 conjugating enzyme; Ubiquitin protein ligase E2I; Ubiquitin-conjugating enzyme E2 I; Ubiquitin-protein ligase I
Function Accepts the ubiquitin-like proteins SUMO1, SUMO2, SUMO3 and SUMO4 from the UBLE1A-UBLE1B E1 complex and catalyzes their covalent attachment to other proteins with the help of an E3 ligase such as RANBP2 or CBX4. Necessary for sumoylation of FOXL2 and KAT5. Essential for nuclear architecture and chromosome segregation.
Cellular Localization Nucleus. Cytoplasm. Mainly nuclear. In spermatocytes, localizes in synaptonemal complexes. Recruited by BCL11A into the nuclear body.
Protein Length Full length protein
Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLVPRGSHMSGIALSRLAQERKAWRKDHPFG FVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPP KCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEP NIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS,Belongs to the ubiquitin-conjugating enzyme family.
Shipping & Storage
Shipping Shipped on dry ice.
Storage Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
logo

Ace Therapeutics has a team of wellknown experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.

Quick Links
Contact Info
Copyright © Ace Therapeutics. All Rights Reserved.
Top