Cat. No.: DPP-001075
Product Overview | |
---|---|
Species | Human |
Expression System | Wheat germ |
Format | Liquid |
Purity | ≥ 95% by SDS-PAGE |
Nature | Recombinant |
Target Information | |
---|---|
Gene Name | SRGN |
UniProt No. | P10124 |
Gene ID | 5552 |
Molecular Weight | 43 kDa including tags |
Alternative Names | Chondroitin sulfate proteoglycan core protein; Cytolytic granule proteoglycan core protein; FLJ12930; gp600; Hematopoetic proteoglycan core protein; Mastocytoma proteoglycan core protein; MGC9289; OTTHUMP00000019716; P.PG; PG19 core protein; Pgsg; Platelet proteoglycan core protein; platelet proteoglycan protein core; PLATELET PROTEOGLYCAN PROTEIN CORE; PPG; PPG; PRG; PRG1; PROTEOGLYCAN 1; proteoglycan 1, secretory granule; Proteoglycan 10K core protein; Proteoglycan peptide core protein; PROTEOGLYCAN PROTEIN CORE FOR MAST CELL SECRETORY GRANULE; secretory granule proteoglycan 1; Secretory granule proteoglycan core peptide; Secretory granule proteoglycan core protein; Serglycin; serglycin proteoglycan; Sgc; Srgn; SRGN_HUMAN |
Function | Plays a role in formation of mast cell secretory granules and mediates storage of various compounds in secretory vesicles. Required for storage of some proteases in both connective tissue and mucosal mast cells and for storage of granzyme B in T lymphocytes. Plays a role in localizing neutrophil elastase in azurophil granules of neutrophils. Mediates processing of MMP2. Plays a role in cytotoxic cell granule-mediated apoptosis by forming a complex with granzyme B which is delivered to cells by perforin to induce apoptosis. Regulates the secretion of TNF-alpha and may also regulate protease secretion. Inhibits bone mineralization. |
Cellular Localization | Cytoplasmic granule. Secreted > extracellular space. Golgi apparatus. Found in mast cell granules and in cytoplasmic granules of cytolytic T lymphocytes from where it is secreted upon cell activation. Secreted constitutively by endothelial cells and macrophages. Located to Golgi apparatus during neutrophil differentiation. |
Protein Length | Full length protein |
Sequence | MMQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCL EEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGS GSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQH GLEEDFML,Belongs to the serglycin family. |
Shipping & Storage | |
---|---|
Shipping | Shipped on dry ice. |
Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. |
Ace Therapeutics has a team of experts in the field of endocrine and metabolic research, aiming to provide innovative preclinical contract research solutions to cope with diabetes and its complications. We provide customized solutions and technical support, enabling the transformation of promising concepts into innovative treatments, thus accelerating the drug development process of diabetes.